Lineage for d5humd_ (5hum D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2075035Protein automated matches [193245] (14 species)
    not a true protein
  7. 2075054Species Influenza a virus (a/chicken/sichuan/ncjpl1/2014(h5n6)) [TaxId:1529593] [315491] (1 PDB entry)
  8. 2075058Domain d5humd_: 5hum D: [315608]
    automated match to d4qn4a_
    complexed with ca, nag

Details for d5humd_

PDB Entry: 5hum (more details), 1.6 Å

PDB Description: the crystal structure of neuraminidase from a/sichuan/26221/2014 influenza virus
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d5humd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5humd_ b.68.1.1 (D:) automated matches {Influenza a virus (a/chicken/sichuan/ncjpl1/2014(h5n6)) [TaxId: 1529593]}
ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr
gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn
asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg
kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk
iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskerlgswswhdgaeiiyfk

SCOPe Domain Coordinates for d5humd_:

Click to download the PDB-style file with coordinates for d5humd_.
(The format of our PDB-style files is described here.)

Timeline for d5humd_: