Lineage for d1ddgb2 (1ddg B:447-599)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1589855Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1589856Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1589988Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (3 proteins)
  6. 1590004Protein Sulfite reductase flavoprotein [52368] (1 species)
  7. 1590005Species Escherichia coli [TaxId:562] [52369] (2 PDB entries)
  8. 1590007Domain d1ddgb2: 1ddg B:447-599 [31560]
    Other proteins in same PDB: d1ddga1, d1ddgb1
    complexed with fad, so4

Details for d1ddgb2

PDB Entry: 1ddg (more details), 2.01 Å

PDB Description: crystal structure of sir-fp60
PDB Compounds: (B:) sulfite reductase (nadph) flavoprotein alpha-component

SCOPe Domain Sequences for d1ddgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddgb2 c.25.1.4 (B:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]}
lpanpetpvimigpgtgiapfrafmqqraadeapgknwlffgnphftedflyqvewqryv
kegvltridlawsrdqkekvyvqdklreqgaelwrwindgahiyvcgdanrmakdveqal
leviaefggmdteaadeflselrverryqrdvy

SCOPe Domain Coordinates for d1ddgb2:

Click to download the PDB-style file with coordinates for d1ddgb2.
(The format of our PDB-style files is described here.)

Timeline for d1ddgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddgb1