Lineage for d1ddga2 (1ddg A:447-599)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22486Family c.25.1.4: NADPH-cytochrome p450 reductase-like [52365] (2 proteins)
  6. 22491Protein Sulfite reductase flavoprotein [52368] (1 species)
  7. 22492Species Escherichia coli [TaxId:562] [52369] (2 PDB entries)
  8. 22493Domain d1ddga2: 1ddg A:447-599 [31559]
    Other proteins in same PDB: d1ddga1, d1ddgb1

Details for d1ddga2

PDB Entry: 1ddg (more details), 2.01 Å

PDB Description: crystal structure of sir-fp60

SCOP Domain Sequences for d1ddga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli}
lpanpetpvimigpgtgiapfrafmqqraadeapgknwlffgnphftedflyqvewqryv
kegvltridlawsrdqkekvyvqdklreqgaelwrwindgahiyvcgdanrmakdveqal
leviaefggmdteaadeflselrverryqrdvy

SCOP Domain Coordinates for d1ddga2:

Click to download the PDB-style file with coordinates for d1ddga2.
(The format of our PDB-style files is described here.)

Timeline for d1ddga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddga1