Lineage for d1ep2b2 (1ep2 B:103-262)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118600Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118601Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2118731Family c.25.1.3: Dihydroorotate dehydrogenase B, PyrK subunit [52362] (2 proteins)
    contains 2Fe-2S cluster in the C-terminal extension
  6. 2118732Protein Dihydroorotate dehydrogenase B, PyrK subunit [52363] (1 species)
  7. 2118733Species Lactococcus lactis, isozyme B [TaxId:1358] [52364] (3 PDB entries)
  8. 2118736Domain d1ep2b2: 1ep2 B:103-262 [31556]
    Other proteins in same PDB: d1ep2a_, d1ep2b1
    complexed with fad, fes, fmn, oro

Details for d1ep2b2

PDB Entry: 1ep2 (more details), 2.4 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate
PDB Compounds: (B:) dihydroorotate dehydrogenase b (pyrk subunit)

SCOPe Domain Sequences for d1ep2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep2b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]}
pvaevtstdkiliigggigvpplyelakqlektgcqmtillgfasenvkilenefsnlkn
vtlkiatddgsygtkghvgmlmneidfevdalytcgapamlkavakkydqlerlyismes
rmacgigacyacvehdkedeshalkvcedgpvflgkqlsl

SCOPe Domain Coordinates for d1ep2b2:

Click to download the PDB-style file with coordinates for d1ep2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ep2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ep2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ep2a_