Lineage for d2piaa2 (2pia A:104-223)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841107Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1841108Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1841223Family c.25.1.2: Aromatic dioxygenase reductase-like [52359] (3 proteins)
    contains additional 2Fe-2S ferredoxin domain at one of the termini
    automatically mapped to Pfam PF00175
  6. 1841231Protein Phthalate dioxygenase reductase [52360] (1 species)
  7. 1841232Species Pseudomonas cepacia, db01 [TaxId:292] [52361] (1 PDB entry)
  8. 1841233Domain d2piaa2: 2pia A:104-223 [31553]
    Other proteins in same PDB: d2piaa1, d2piaa3
    complexed with fes, fmn

Details for d2piaa2

PDB Entry: 2pia (more details), 2 Å

PDB Description: phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s]
PDB Compounds: (A:) phthalate dioxygenase reductase

SCOPe Domain Sequences for d2piaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]}
efpldkraksfilvaggigitpmlsmarqlraeglrsfrlyyltrdpegtaffdeltsde
wrsdvkihhdhgdptkafdfwsvfekskpaqhvyccgpqalmdtvrdmtghwpsgtvhfe

SCOPe Domain Coordinates for d2piaa2:

Click to download the PDB-style file with coordinates for d2piaa2.
(The format of our PDB-style files is described here.)

Timeline for d2piaa2: