SCOPe 2.03: Domain d1cnea2: 1cne A:125-270

Lineage for d1cnea2 (1cne A:125-270)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein Nitrate reductase [52355] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [52356] (3 PDB entries)

8. Domain d1cnea2: 1cne A:125-270 [31551]
   Other proteins in same PDB: d1cnea1
   complexed with fad; mutant

Details for d1cnea2

PDB Entry: 1cne, 3 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

PDB Compounds: (A:) nitrate reductase

SCOPe Domain Sequences for d1cnea2:

Sequence; same for both SEQRES and ATOM records:

>d1cnea2 c.25.1.1 (A:125-270) Nitrate reductase {Maize (Zea mays) [TaxId: 4577]}
gsfvingkqrnarrlamicggsgitpmyqiiqavlrdqpedhtemhlvyanrteddillr
deldrwaaeypdrlkvwyvidqvkrpeegwkysvgfvteavlrehvpeggddtlalasgp
ppmiqfaispnlekmkydmansfvvf

Timeline for d1cnea2:

• d1cnea2 first appeared (with stable ids) in SCOP 1.55, called d1cne_2
  
• d1cnea2 appears in SCOPe 2.02
  
• d1cnea2 appears in SCOPe 2.04
  
• d1cnea2 appears in the current release, SCOPe 2.08