Lineage for d5ifza_ (5ifz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169121Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2169122Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2169174Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2169175Protein automated matches [191196] (8 species)
    not a true protein
  7. 2169179Species Brucella melitensis [TaxId:224914] [315464] (1 PDB entry)
  8. 2169180Domain d5ifza_: 5ifz A: [315483]
    automated match to d3he8a_

Details for d5ifza_

PDB Entry: 5ifz (more details), 1.6 Å

PDB Description: crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d5ifza_:

Sequence, based on SEQRES records: (download)

>d5ifza_ c.121.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
mkvavagdsageglakvladhlkdrfevseisrtdagadafyanlsdrvasavldgtydr
ailvcgtgigvciaankvpgiraalthdtysaeraalsnnaqiitmgarvigaevaktia
daflaqtfd

Sequence, based on observed residues (ATOM records): (download)

>d5ifza_ c.121.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
mkvavagdsageglakvladhlkdrfevseisnlsdrvasavldgtydrailvcgtgigv
ciaankvpgiraalthdtysaeraalsnnaqiitmgarvigaevaktiadaflaqtfd

SCOPe Domain Coordinates for d5ifza_:

Click to download the PDB-style file with coordinates for d5ifza_.
(The format of our PDB-style files is described here.)

Timeline for d5ifza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ifzb_