Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species) |
Domain d1ewyb2: 1ewy B:142-303 [31542] Other proteins in same PDB: d1ewya1, d1ewyb1, d1ewyc_ complexed with fad, fes |
PDB Entry: 1ewy (more details), 2.38 Å
SCOPe Domain Sequences for d1ewyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewyb2 c.25.1.1 (B:142-303) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
Timeline for d1ewyb2: