Lineage for d5hpsb_ (5hps B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933269Domain d5hpsb_: 5hps B: [315417]
    Other proteins in same PDB: d5hpsa_
    automated match to d2knba_

Details for d5hpsb_

PDB Entry: 5hps (more details), 2.05 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: wwp1 and ubv p1.1
PDB Compounds: (B:) Ubiquitin variant P1.1

SCOPe Domain Sequences for d5hpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpsb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mhifvktlrgwsitlevepsdtienvkakiqdkegippdqqilifarkkledgrtlsdyn
iqeksslylflrl

SCOPe Domain Coordinates for d5hpsb_:

Click to download the PDB-style file with coordinates for d5hpsb_.
(The format of our PDB-style files is described here.)

Timeline for d5hpsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hpsa_