SCOP 1.59: Domain d1ewya2: 1ewy A:142-303

Lineage for d1ewya2 (1ewy A:142-303)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (12 PDB entries)

8. Domain d1ewya2: 1ewy A:142-303 [31541]
   Other proteins in same PDB: d1ewya1, d1ewyb1, d1ewyc_

Details for d1ewya2

PDB Entry: 1ewy, 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

SCOP Domain Sequences for d1ewya2:

Sequence; same for both SEQRES and ATOM records:

>d1ewya2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

Timeline for d1ewya2:

• d1ewya2 first appeared (with stable ids) in SCOP 1.55
  
• d1ewya2 appears in SCOP 1.57
  
• d1ewya2 appears in SCOP 1.61
  
• d1ewya2 appears in the current release, SCOPe 2.08