Lineage for d1ewya2 (1ewy A:142-303)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22424Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 22428Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species)
  7. 22431Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (5 PDB entries)
  8. 22436Domain d1ewya2: 1ewy A:142-303 [31541]
    Other proteins in same PDB: d1ewya1, d1ewyb1, d1ewyc_

Details for d1ewya2

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

SCOP Domain Sequences for d1ewya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewya2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d1ewya2:

Click to download the PDB-style file with coordinates for d1ewya2.
(The format of our PDB-style files is described here.)

Timeline for d1ewya2: