Lineage for d5h8yf_ (5h8y F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179171Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2179172Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2179208Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries)
  8. 2179218Domain d5h8yf_: 5h8y F: [315404]
    automated match to d1gaqb_
    complexed with cl, fes, mg, sf4, srm

Details for d5h8yf_

PDB Entry: 5h8y (more details), 2.2 Å

PDB Description: crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-2 crystal
PDB Compounds: (F:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d5h8yf_:

Sequence, based on SEQRES records: (download)

>d5h8yf_ d.15.4.1 (F:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
litpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsdqsyldd
gqiadgwvltchayptsdvviethkeeelt

Sequence, based on observed residues (ATOM records): (download)

>d5h8yf_ d.15.4.1 (F:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
litpegevgidlpyscragscsscagkvvsgsvdqsdqsylddgqiadgwvltchaypts
dvviethkeeelt

SCOPe Domain Coordinates for d5h8yf_:

Click to download the PDB-style file with coordinates for d5h8yf_.
(The format of our PDB-style files is described here.)

Timeline for d5h8yf_: