Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
Protein automated matches [190431] (13 species) not a true protein |
Species Lavandula lanata [TaxId:39330] [315377] (3 PDB entries) |
Domain d5hc7a_: 5hc7 A: [315380] automated match to d2d2rb_ complexed with dst, mg |
PDB Entry: 5hc7 (more details), 2.05 Å
SCOPe Domain Sequences for d5hc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hc7a_ c.101.1.0 (A:) automated matches {Lavandula lanata [TaxId: 39330]} devtpnhvaiiidghrkwaksrgvtvqeghqtgvnnwkhiisrasqlgiklltiwalspq nfnrskmevdflmriyedflrsdvkelvtsqqdiqfsaigdksrlpeylqdaisyaegls qankgmhfilavayggrediveaarkiaakvehgilrpddideatfeqhlmtnitkfpsp dlliraageqrlsnfflwqlpftefyftpklfpdfgeadlldalasyrcr
Timeline for d5hc7a_: