Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) |
Family c.25.1.1: Reductases [52344] (4 proteins) |
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) |
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (8 PDB entries) |
Domain d1b2ra2: 1b2r A:142-303 [31538] Other proteins in same PDB: d1b2ra1 |
PDB Entry: 1b2r (more details), 1.8 Å
SCOP Domain Sequences for d1b2ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2ra2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvaty
Timeline for d1b2ra2: