SCOPe 2.06: Domain d5h8ye_: 5h8y E:

Lineage for d5h8ye_ (5h8y E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries)

8. Domain d5h8ye_: 5h8y E: [315370]
   automated match to d1gaqb_
   complexed with cl, fes, mg, sf4, srm

Details for d5h8ye_

PDB Entry: 5h8y, 2.2 Å

PDB Description: crystal structure of the complex between maize sulfite reductase and ferredoxin in the form-2 crystal

PDB Compounds: (E:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d5h8ye_:

Sequence; same for both SEQRES and ATOM records:

>d5h8ye_ d.15.4.1 (E:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeelt

Timeline for d5h8ye_:

• d5h8ye_ is new in SCOPe 2.06-stable
  
• d5h8ye_ appears in SCOPe 2.07
  
• d5h8ye_ appears in the current release, SCOPe 2.08