Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (19 species) |
Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries) |
Domain d5h8ye_: 5h8y E: [315370] automated match to d1gaqb_ complexed with cl, fes, mg, sf4, srm |
PDB Entry: 5h8y (more details), 2.2 Å
SCOPe Domain Sequences for d5h8ye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h8ye_ d.15.4.1 (E:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]} atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd qsylddgqiadgwvltchayptsdvviethkeeelt
Timeline for d5h8ye_: