Lineage for d1gaqc2 (1gaq C:157-314)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22424Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 22428Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species)
  7. 22449Species Maize (Zea mays) [TaxId:4577] [52349] (2 PDB entries)
  8. 22453Domain d1gaqc2: 1gaq C:157-314 [31536]
    Other proteins in same PDB: d1gaqa1, d1gaqb_, d1gaqc1

Details for d1gaqc2

PDB Entry: 1gaq (more details), 2.59 Å

PDB Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase

SCOP Domain Sequences for d1gaqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaqc2 c.25.1.1 (C:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays)}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOP Domain Coordinates for d1gaqc2:

Click to download the PDB-style file with coordinates for d1gaqc2.
(The format of our PDB-style files is described here.)

Timeline for d1gaqc2: