Lineage for d1gawb2 (1gaw B:157-314)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178377Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 178378Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 178379Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 178386Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 178415Species Maize (Zea mays), leaf isoform [TaxId:4577] [52349] (2 PDB entries)
  8. 178417Domain d1gawb2: 1gaw B:157-314 [31534]
    Other proteins in same PDB: d1gawa1, d1gawb1

Details for d1gawb2

PDB Entry: 1gaw (more details), 2.2 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf

SCOP Domain Sequences for d1gawb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gawb2 c.25.1.1 (B:157-314) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), leaf isoform}
mpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglgwlflgvptsssllykeef
gkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeelwellkkdntyvymcglkg
mekgiddimvslaekdgidwfdykkqlkrgdqwnvevy

SCOP Domain Coordinates for d1gawb2:

Click to download the PDB-style file with coordinates for d1gawb2.
(The format of our PDB-style files is described here.)

Timeline for d1gawb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gawb1