Lineage for d5e0sl_ (5e0s L:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113433Species Mycobacterium tuberculosis [TaxId:83331] [315286] (1 PDB entry)
  8. 2113445Domain d5e0sl_: 5e0s L: [315288]
    automated match to d2cbyd_

Details for d5e0sl_

PDB Entry: 5e0s (more details), 2.9 Å

PDB Description: crystal structure of the active form of the proteolytic complex clpp1 and clpp2
PDB Compounds: (L:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d5e0sl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0sl_ c.14.1.0 (L:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr

SCOPe Domain Coordinates for d5e0sl_:

Click to download the PDB-style file with coordinates for d5e0sl_.
(The format of our PDB-style files is described here.)

Timeline for d5e0sl_: