SCOPe 2.06: Domain d5i4db2: 5i4d B:256-356

Lineage for d5i4db2 (5i4d B:256-356)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [267924] (2 PDB entries)

8. Domain d5i4db2: 5i4d B:256-356 [315270]
   Other proteins in same PDB: d5i4da1, d5i4db1
   automated match to d4dxga2
   complexed with fuc, gal, nag, ndg, pg4, pge, sia

Details for d5i4db2

PDB Entry: 5i4d, 1.75 Å

PDB Description: 1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.

PDB Compounds: (B:) Superantigen-like protein

SCOPe Domain Sequences for d5i4db2:

Sequence; same for both SEQRES and ATOM records:

>d5i4db2 d.15.6.0 (B:256-356) automated matches {Staphylococcus aureus [TaxId: 426430]}
kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt
ivikmknggkytfelhkklqehrmadvidgtnidnievnik

Timeline for d5i4db2:

• d5i4db2 is new in SCOPe 2.06-stable
  
• d5i4db2 appears in SCOPe 2.07
  
• d5i4db2 appears in the current release, SCOPe 2.08