SCOPe 2.06: Domain d5i4db1: 5i4d B:164-255

Lineage for d5i4db1 (5i4d B:164-255)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226094] (7 PDB entries)

8. Domain d5i4db1: 5i4d B:164-255 [315269]
   Other proteins in same PDB: d5i4da2, d5i4db2
   automated match to d3urya1
   complexed with fuc, gal, nag, ndg, pg4, pge, sia

Details for d5i4db1

PDB Entry: 5i4d, 1.75 Å

PDB Description: 1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.

PDB Compounds: (B:) Superantigen-like protein

SCOPe Domain Sequences for d5i4db1:

Sequence; same for both SEQRES and ATOM records:

>d5i4db1 b.40.2.0 (B:164-255) automated matches {Staphylococcus aureus [TaxId: 93061]}
mtpkyedlrayytkpsfefekqfgfmlkpwttvrfmnvipnrfiykialvgkdekkykdg
pydnidvfivlednkyqlkkysvggitktnsk

Timeline for d5i4db1:

• d5i4db1 is new in SCOPe 2.06-stable
  
• d5i4db1 appears in SCOPe 2.07
  
• d5i4db1 appears in the current release, SCOPe 2.08