Lineage for d1qfyb2 (1qfy B:654-808)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178377Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 178378Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 178379Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 178386Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 178406Species Garden pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)
  8. 178410Domain d1qfyb2: 1qfy B:654-808 [31526]
    Other proteins in same PDB: d1qfya1, d1qfyb1

Details for d1qfyb2

PDB Entry: 1qfy (more details), 1.8 Å

PDB Description: pea fnr y308s mutant in complex with nadp+

SCOP Domain Sequences for d1qfyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfyb2 c.25.1.1 (B:654-808) Ferredoxin reductase (flavodoxin reductase) {Garden pea (Pisum sativum)}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevs

SCOP Domain Coordinates for d1qfyb2:

Click to download the PDB-style file with coordinates for d1qfyb2.
(The format of our PDB-style files is described here.)

Timeline for d1qfyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfyb1