SCOPe 2.05: Domain d1qfya2: 1qfy A:154-308

Lineage for d1qfya2 (1qfy A:154-308)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)

8. Domain d1qfya2: 1qfy A:154-308 [31525]
   Other proteins in same PDB: d1qfya1, d1qfyb1
   complexed with fad, nap, so4; mutant

Details for d1qfya2

PDB Entry: 1qfy, 1.8 Å

PDB Description: pea fnr y308s mutant in complex with nadp+

PDB Compounds: (A:) protein (ferredoxin: nadp+ reductase)

SCOPe Domain Sequences for d1qfya2:

Sequence; same for both SEQRES and ATOM records:

>d1qfya2 c.25.1.1 (A:154-308) Ferredoxin reductase (flavodoxin reductase) {Pea (Pisum sativum) [TaxId: 3888]}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevs

Timeline for d1qfya2:

• d1qfya2 first appeared (with stable ids) in SCOP 1.55
  
• d1qfya2 appears in SCOPe 2.04
  
• d1qfya2 appears in SCOPe 2.06
  
• d1qfya2 appears in the current release, SCOPe 2.08