Lineage for d5an4a1 (5an4 A:12-135)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538859Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2538926Protein automated matches [315231] (1 species)
    not a true protein
  7. 2538927Species Human (Homo sapiens) [TaxId:9606] [315232] (1 PDB entry)
  8. 2538928Domain d5an4a1: 5an4 A:12-135 [315233]
    Other proteins in same PDB: d5an4a2
    automated match to d1m3qa2
    complexed with so4

Details for d5an4a1

PDB Entry: 5an4 (more details), 1.6 Å

PDB Description: crystal structure of the human 8-oxoguanine glycosylase (ogg1) processed with the crystaldirect automated mounting and cryo-cooling technology
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d5an4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5an4a1 d.129.1.2 (A:12-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

SCOPe Domain Coordinates for d5an4a1:

Click to download the PDB-style file with coordinates for d5an4a1.
(The format of our PDB-style files is described here.)

Timeline for d5an4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5an4a2