Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Nematostella vectensis [TaxId:45351] [314982] (1 PDB entry) |
Domain d5ig4d_: 5ig4 D: [315205] automated match to d1hkxe_ complexed with gol |
PDB Entry: 5ig4 (more details), 2.35 Å
SCOPe Domain Sequences for d5ig4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ig4d_ d.17.4.0 (D:) automated matches {Nematostella vectensis [TaxId: 45351]} takvreqeiirltqklitsittgdydtysklvdphvtcfepfsngnlveglefhkfyfdn tlskrsvpinttilsphvhvlgedaacicymrltqsvnssgeaktlqqeetrvwqkkggn winvhfhisg
Timeline for d5ig4d_: