Lineage for d1bx0a2 (1bx0 A:155-314)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) 
binds NADP differently than classical Rossmann-fold
N-terminal FAD-linked domain contains (6,10) barrelFamily c.25.1.1: Reductases [52344] (5 proteins) 
Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species) 
Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries) 
Domain d1bx0a2: 1bx0 A:155-314 [31520]
Other proteins in same PDB: d1bx0a1
complexed with fad, po4, so4; mutant
Details for d1bx0a2
PDB Entry: 1bx0 (more details), 1.9 Å
PDB Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l
PDB Compounds: (A:) protein (ferredoxin:nadp+ oxidoreductase)SCOPe Domain Sequences for d1bx0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx0a2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyfymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvlvy
SCOPe Domain Coordinates for d1bx0a2:
Click to download the PDB-style file with coordinates for d1bx0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bx0a2:
- d1bx0a2 first appeared (with stable ids) in SCOP 1.55
- d1bx0a2 appears in SCOPe 2.07
View in 3D
