SCOP 1.59: Domain d1fnb_2: 1fnb 155-314

Lineage for d1fnb_2 (1fnb 155-314)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)

8. Domain d1fnb_2: 1fnb 155-314 [31518]
   Other proteins in same PDB: d1fnb_1

Details for d1fnb_2

PDB Entry: 1fnb, 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnb_2:

Sequence; same for both SEQRES and ATOM records:

>d1fnb_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

Timeline for d1fnb_2:

• d1fnb_2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnb_2 appears in SCOP 1.57
  
• d1fnb_2 appears in SCOP 1.61
  
• d1fnb_2 appears in the current release, SCOPe 2.08, called d1fnba2