Lineage for d1fnc_2 (1fnc 155-314)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178377Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 178378Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 178379Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 178386Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 178425Species Spinach (Spinacia oleracea) [TaxId:3562] [52346] (7 PDB entries)
  8. 178426Domain d1fnc_2: 1fnc 155-314 [31517]
    Other proteins in same PDB: d1fnc_1

Details for d1fnc_2

PDB Entry: 1fnc (more details), 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnc_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnc_2 c.25.1.1 (155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea)}
mlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllyke
efekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavelwemlkkdntyvymcgl
kgmekgiddimvslaaaegidwieykrqlkkaeqwnvevy

SCOP Domain Coordinates for d1fnc_2:

Click to download the PDB-style file with coordinates for d1fnc_2.
(The format of our PDB-style files is described here.)

Timeline for d1fnc_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnc_1