Lineage for d5ibda_ (5ibd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2330984Protein Cyp121 monooxygenase (P450 Mt2) [81865] (3 species)
  7. 2330987Species Mycobacterium tuberculosis [TaxId:1773] [81866] (37 PDB entries)
  8. 2331028Domain d5ibda_: 5ibd A: [315100]
    automated match to d1n40a_
    complexed with ggj, hem, so4

Details for d5ibda_

PDB Entry: 5ibd (more details), 1.77 Å

PDB Description: crystal structure mycobacterium tuberculosis cyp121 in complex with inhibitor fragment 24a
PDB Compounds: (A:) Mycocyclosin synthase

SCOPe Domain Sequences for d5ibda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ibda_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
lkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d5ibda_:

Click to download the PDB-style file with coordinates for d5ibda_.
(The format of our PDB-style files is described here.)

Timeline for d5ibda_: