Lineage for d5iqpb_ (5iqp B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333696Species Human (Homo sapiens) [TaxId:9606] [187008] (44 PDB entries)
  8. 2333749Domain d5iqpb_: 5iqp B: [315083]
    automated match to d4dnkb_
    complexed with so4

Details for d5iqpb_

PDB Entry: 5iqp (more details), 2.6 Å

PDB Description: 14-3-3 protein tau isoform
PDB Compounds: (B:) 14-3-3 protein theta

SCOPe Domain Sequences for d5iqpb_:

Sequence, based on SEQRES records: (download)

>d5iqpb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
vissieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylk
mkgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyye
ilnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d5iqpb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
vissieqktdtdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylkm
kgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyyei
lnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d5iqpb_:

Click to download the PDB-style file with coordinates for d5iqpb_.
(The format of our PDB-style files is described here.)

Timeline for d5iqpb_: