Lineage for d5iqpa_ (5iqp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010544Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2010545Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2010595Protein automated matches [190238] (9 species)
    not a true protein
  7. 2010604Species Human (Homo sapiens) [TaxId:9606] [187008] (42 PDB entries)
  8. 2010660Domain d5iqpa_: 5iqp A: [315077]
    automated match to d4dnkb_
    complexed with so4

Details for d5iqpa_

PDB Entry: 5iqp (more details), 2.6 Å

PDB Description: 14-3-3 protein tau isoform
PDB Compounds: (A:) 14-3-3 protein theta

SCOPe Domain Sequences for d5iqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iqpa_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
vissieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylk
mkgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyye
ilnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d5iqpa_:

Click to download the PDB-style file with coordinates for d5iqpa_.
(The format of our PDB-style files is described here.)

Timeline for d5iqpa_: