Lineage for d1jdbk2 (1jdb K:936-1072)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579759Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 579760Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 579761Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 579762Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 579763Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
  8. 579779Domain d1jdbk2: 1jdb K:936-1072 [31506]
    Other proteins in same PDB: d1jdbb1, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2
    complexed with adp, cl, e4n, k, mn, orn, po4

Details for d1jdbk2

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbk2 c.24.1.1 (K:936-1072) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
stmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvhe
grphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamalna
datekvisvqemhaqik

SCOP Domain Coordinates for d1jdbk2:

Click to download the PDB-style file with coordinates for d1jdbk2.
(The format of our PDB-style files is described here.)

Timeline for d1jdbk2: