Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Horse (Equus caballus) [TaxId:9796] [256129] (14 PDB entries) |
Domain d5iiha1: 5iih A:4-195 [315057] automated match to d1hk5a2 complexed with so4, zn |
PDB Entry: 5iih (more details), 2.4 Å
SCOPe Domain Sequences for d5iiha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iiha1 a.126.1.0 (A:4-195) automated matches {Horse (Equus caballus) [TaxId: 9796]} kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda lkerillssake
Timeline for d5iiha1: