Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
Protein automated matches [190062] (8 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:381754] [314866] (1 PDB entry) |
Domain d5i21a_: 5i21 A: [315051] automated match to d3quia_ complexed with cl |
PDB Entry: 5i21 (more details), 1.55 Å
SCOPe Domain Sequences for d5i21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i21a_ b.38.1.2 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]} slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhaistvvps rpvrl
Timeline for d5i21a_: