Lineage for d5i21a_ (5i21 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057429Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2057545Protein automated matches [190062] (8 species)
    not a true protein
  7. 2057635Species Pseudomonas aeruginosa [TaxId:381754] [314866] (1 PDB entry)
  8. 2057636Domain d5i21a_: 5i21 A: [315051]
    automated match to d3quia_
    complexed with cl

Details for d5i21a_

PDB Entry: 5i21 (more details), 1.55 Å

PDB Description: y55w hfq from pseudomonas aeruginosa
PDB Compounds: (A:) RNA-binding protein Hfq

SCOPe Domain Sequences for d5i21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i21a_ b.38.1.2 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhaistvvps
rpvrl

SCOPe Domain Coordinates for d5i21a_:

Click to download the PDB-style file with coordinates for d5i21a_.
(The format of our PDB-style files is described here.)

Timeline for d5i21a_: