SCOPe 2.06: Domain d5i2jb_: 5i2j B:

Lineage for d5i2jb_ (5i2j B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries)

8. Domain d5i2jb_: 5i2j B: [315012]
   Other proteins in same PDB: d5i2ja_
   automated match to d1pb7a_
   complexed with 67g, act, glu, gly

Details for d5i2jb_

PDB Entry: 5i2j, 2.44 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with gne0723

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5i2jb_:

Sequence, based on SEQRES records:

>d5i2jb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq

Sequence, based on observed residues (ATOM records):

>d5i2jb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq

Timeline for d5i2jb_:

• d5i2jb_ appears in periodic updates to SCOPe 2.06 starting on 2016-04-15
  
• d5i2jb_ became obsolete in SCOPe 2.07