![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
![]() | Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species) |
![]() | Species Homo sapiens [TaxId:9606] [314718] (12 PDB entries) |
![]() | Domain d5i2jb_: 5i2j B: [315012] Other proteins in same PDB: d5i2ja_ automated match to d1pb7a_ complexed with 67g, act, glu, gly |
PDB Entry: 5i2j (more details), 2.44 Å
SCOPe Domain Sequences for d5i2jb_:
Sequence, based on SEQRES records: (download)
>d5i2jb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]} mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq
>d5i2jb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Homo sapiens [TaxId: 9606]} mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq ccygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivap ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq
Timeline for d5i2jb_: