Lineage for d1bxre2 (1bxr E:936-1073)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859567Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 2859568Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 2859569Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
    Uniprot P00968
  8. 2859576Domain d1bxre2: 1bxr E:936-1073 [31501]
    Other proteins in same PDB: d1bxra1, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2
    complexed with anp, cl, k, mn, net, orn

Details for d1bxre2

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp
PDB Compounds: (E:) carbamoyl-phosphate synthase

SCOPe Domain Sequences for d1bxre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxre2 c.24.1.1 (E:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOPe Domain Coordinates for d1bxre2:

Click to download the PDB-style file with coordinates for d1bxre2.
(The format of our PDB-style files is described here.)

Timeline for d1bxre2: