Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [314895] (3 PDB entries) |
Domain d5hsxa_: 5hsx A: [315000] automated match to d1oiic_ complexed with edo, gol, na |
PDB Entry: 5hsx (more details), 1.8 Å
SCOPe Domain Sequences for d5hsxa_:
Sequence, based on SEQRES records: (download)
>d5hsxa_ b.82.2.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]} sievtplsahigaeihgvdltqklearqiaeiraallkwrvvffreqfltheqhvafsaq fgeltlghpvfghveghpevysiskyrkatrfegqtlqrpwtgwhtdvtaavnppwasil rgvtippyggdtqwtnlvaayqklsaplrsfvdglrgihrftppagasgtqafveaveqr ilvtehplvrvhpetgeralyvspsflksivgvspresqvllellwehvtrpeftvrfkw qagsvafwdnratahlaptdifdldfdrqlyrttlvgdvpvgpdgtqsvaiegspv
>d5hsxa_ b.82.2.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]} sievtplsahigaeihgvdltqklearqiaeiraallkwrvvffreqfltheqhvafsaq fgeltlgvfghveghpevysiskyqtlqrpwtgwhtdvtaavnppwasilrgvtippygg dtqwtnlvaayqklsaplrsfvdglrgihrftprilvtehplvrvhpetgeralyvspsf lksivgvspresqvllellwehvtrpeftvrfkwqagsvafwdnratahlaptdifdldf drqlyrttlvgdvpvgpdgtqsvaiegspv
Timeline for d5hsxa_: