Lineage for d5idua1 (5idu A:6-238)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570599Species Burkholderia phymatum [TaxId:391038] [314995] (1 PDB entry)
  8. 2570600Domain d5idua1: 5idu A:6-238 [314996]
    Other proteins in same PDB: d5idua2, d5idub2, d5iduc2, d5iduc3, d5idud2
    automated match to d4p13a1
    complexed with edo, fad

Details for d5idua1

PDB Entry: 5idu (more details), 1.95 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad
PDB Compounds: (A:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d5idua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idua1 e.6.1.0 (A:6-238) automated matches {Burkholderia phymatum [TaxId: 391038]}
idphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwlkygv
ggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkirylpr
vskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvfartg
eapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgap

SCOPe Domain Coordinates for d5idua1:

Click to download the PDB-style file with coordinates for d5idua1.
(The format of our PDB-style files is described here.)

Timeline for d5idua1: