Lineage for d1bxra2 (1bxr A:936-1073)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22377Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 22378Superfamily c.24.1: Methylglyoxal synthase-like [52335] (2 families) (S)
  5. 22379Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 22380Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 22381Species Escherichia coli [TaxId:562] [52338] (7 PDB entries)
  8. 22402Domain d1bxra2: 1bxr A:936-1073 [31499]
    Other proteins in same PDB: d1bxra1, d1bxra3, d1bxra4, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc3, d1bxrc4, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre3, d1bxre4, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg3, d1bxrg4, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2

Details for d1bxra2

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxra2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1bxra2:

Click to download the PDB-style file with coordinates for d1bxra2.
(The format of our PDB-style files is described here.)

Timeline for d1bxra2: