Lineage for d5hsga_ (5hsg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913431Species Klebsiella pneumoniae [TaxId:272620] [188448] (2 PDB entries)
  8. 2913432Domain d5hsga_: 5hsg A: [314987]
    automated match to d2gx6a_
    complexed with mg

Details for d5hsga_

PDB Entry: 5hsg (more details), 1.3 Å

PDB Description: crystal structure of an abc transporter solute binding protein from klebsiella pneumoniae (kpn_01730, target efi-511059), apo open structure
PDB Compounds: (A:) Putative ABC transporter, nucleotide binding/ATPase protein

SCOPe Domain Sequences for d5hsga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hsga_ c.93.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
gptyalvqinqqalffnlmnkgaqdaakasgkdlvifnsndnpvaqndaienyiqqgvkg
ilvaaidvngimpavkeaaaanipviaidavlpagpqaaqvgvdnieggriigqyfvdyv
qkemggqarlgivgalnsaiqnqrqkgfeetlksnpkitianvvdgqnvqdkamtaaenl
itgnpdltaiyatgepallgaiaavenqgrqkdikvfgwdltakaisgidggyvtavlqq
dpekmgaealnalnsitsgktvpktilvpatvvtkanvdsyrplf

SCOPe Domain Coordinates for d5hsga_:

Click to download the PDB-style file with coordinates for d5hsga_.
(The format of our PDB-style files is described here.)

Timeline for d5hsga_: