Lineage for d5iaia_ (5iai A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915203Species Agrobacterium radiobacter [TaxId:311403] [314972] (1 PDB entry)
  8. 2915204Domain d5iaia_: 5iai A: [314973]
    automated match to d5ci5a_
    complexed with gol, rb0

Details for d5iaia_

PDB Entry: 5iai (more details), 1.6 Å

PDB Description: crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
PDB Compounds: (A:) Sugar ABC transporter

SCOPe Domain Sequences for d5iaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iaia_ c.94.1.0 (A:) automated matches {Agrobacterium radiobacter [TaxId: 311403]}
kpldgvtltlasqndpfgavltklaaefkqdtgadlkvevmdygtlltkttadfvgktkg
ydlvtmdivwagayqangysvdltdwvkrdaaeldlddiypvilqslgqykghyvafpfa
ayanvlayrkdlfqaaglpvpttveelvsdakkltdpskkqygfvangqkgpavaqdwmq
ynnqmggsildndgkpalnspenvksltvykqlfvetappgaieydwggreesfrqgaaa
mmqtwsvgapgysdpassnvvgkvgittapvgkgvppqygvggwgmainadidpkqkeaa
wtfikwlvskkihkefnmdgagsfmrksqmtdpdltakfdflpvvaktyengngeyrpri
peypeiqdilgsavnsvlagaaepqaaldeaqveakklf

SCOPe Domain Coordinates for d5iaia_:

Click to download the PDB-style file with coordinates for d5iaia_.
(The format of our PDB-style files is described here.)

Timeline for d5iaia_: