Lineage for d5i0za_ (5i0z A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034812Domain d5i0za_: 5i0z A: [314947]
    automated match to d1bzqk_

Details for d5i0za_

PDB Entry: 5i0z (more details), 1.9 Å

PDB Description: crystal structure of the single domain catalytic antibody 3d8-vh
PDB Compounds: (A:) catalytic DNA antibody

SCOPe Domain Sequences for d5i0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i0za_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycargaykrgyamdywgqgtsvtvss

SCOPe Domain Coordinates for d5i0za_:

Click to download the PDB-style file with coordinates for d5i0za_.
(The format of our PDB-style files is described here.)

Timeline for d5i0za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5i0zb_