Lineage for d5i11a_ (5i11 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783393Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)
  8. 2783417Domain d5i11a_: 5i11 A: [314941]
    automated match to d1e6ga_
    complexed with act, peg, pge, so4; mutant

Details for d5i11a_

PDB Entry: 5i11 (more details), 1.95 Å

PDB Description: crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t114s-q128r mutant
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d5i11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i11a_ b.34.2.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnnsegdwwlahslttgrtgyipsnyvaps

SCOPe Domain Coordinates for d5i11a_:

Click to download the PDB-style file with coordinates for d5i11a_.
(The format of our PDB-style files is described here.)

Timeline for d5i11a_: