Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries) |
Domain d5i4da1: 5i4d A:165-255 [314933] Other proteins in same PDB: d5i4da2, d5i4db2 automated match to d3urya1 complexed with fuc, gal, nag, ndg, pg4, pge, sia |
PDB Entry: 5i4d (more details), 1.75 Å
SCOPe Domain Sequences for d5i4da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4da1 b.40.2.0 (A:165-255) automated matches {Staphylococcus aureus [TaxId: 1280]} tpkyedlrayytkpsfefekqfgfmlkpwttvrfmnvipnrfiykialvgkdekkykdgp ydnidvfivlednkyqlkkysvggitktnsk
Timeline for d5i4da1: