Lineage for d5i4da1 (5i4d A:165-255)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398788Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2398789Protein automated matches [226834] (6 species)
    not a true protein
  7. 2398790Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)
  8. 2398796Domain d5i4da1: 5i4d A:165-255 [314933]
    Other proteins in same PDB: d5i4da2, d5i4db2
    automated match to d3urya1
    complexed with fuc, gal, nag, ndg, pg4, pge, sia

Details for d5i4da1

PDB Entry: 5i4d (more details), 1.75 Å

PDB Description: 1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
PDB Compounds: (A:) Superantigen-like protein

SCOPe Domain Sequences for d5i4da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4da1 b.40.2.0 (A:165-255) automated matches {Staphylococcus aureus [TaxId: 1280]}
tpkyedlrayytkpsfefekqfgfmlkpwttvrfmnvipnrfiykialvgkdekkykdgp
ydnidvfivlednkyqlkkysvggitktnsk

SCOPe Domain Coordinates for d5i4da1:

Click to download the PDB-style file with coordinates for d5i4da1.
(The format of our PDB-style files is described here.)

Timeline for d5i4da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i4da2