Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Brucella ovis [TaxId:1293916] [275354] (2 PDB entries) |
Domain d5ha5a_: 5ha5 A: [314929] automated match to d1pr9a_ complexed with edo, imd, nad |
PDB Entry: 5ha5 (more details), 1.95 Å
SCOPe Domain Sequences for d5ha5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ha5a_ c.2.1.0 (A:) automated matches {Brucella ovis [TaxId: 1293916]} mellkeklvlvtgagrglgaaissgaaeqgarvilvdidgtaakaqadaltakgfvaegh aldvtdrdavaaladdilsrfggldvlvnnagvagraafdqpeavevwdrvigvnlegaf nvshalvpalkaakgnvvhlcsvagfvsggstagyvvskgairsltqvmardlaphgirv navapgimmsemavaqlnrpggtdwfmnrvmmkrigetsevvdpvvflaspmasyitgti lpvdggflaa
Timeline for d5ha5a_: