Lineage for d5ha5a_ (5ha5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846286Species Brucella ovis [TaxId:1293916] [275354] (2 PDB entries)
  8. 2846291Domain d5ha5a_: 5ha5 A: [314929]
    automated match to d1pr9a_
    complexed with edo, imd, nad

Details for d5ha5a_

PDB Entry: 5ha5 (more details), 1.95 Å

PDB Description: crystal structure of an nad-bound oxidoreductase from brucella ovis
PDB Compounds: (A:) Brucella ovis oxidoreductase

SCOPe Domain Sequences for d5ha5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ha5a_ c.2.1.0 (A:) automated matches {Brucella ovis [TaxId: 1293916]}
mellkeklvlvtgagrglgaaissgaaeqgarvilvdidgtaakaqadaltakgfvaegh
aldvtdrdavaaladdilsrfggldvlvnnagvagraafdqpeavevwdrvigvnlegaf
nvshalvpalkaakgnvvhlcsvagfvsggstagyvvskgairsltqvmardlaphgirv
navapgimmsemavaqlnrpggtdwfmnrvmmkrigetsevvdpvvflaspmasyitgti
lpvdggflaa

SCOPe Domain Coordinates for d5ha5a_:

Click to download the PDB-style file with coordinates for d5ha5a_.
(The format of our PDB-style files is described here.)

Timeline for d5ha5a_: