Lineage for d5hptc_ (5hpt C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939466Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2939467Protein automated matches [190120] (9 species)
    not a true protein
  7. 2939474Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)
  8. 2939513Domain d5hptc_: 5hpt C: [314917]
    Other proteins in same PDB: d5hpta_, d5hptb_, d5hptd_, d5hpte_, d5hptg_, d5hpth_
    automated match to d2e2ca_

Details for d5hptc_

PDB Entry: 5hpt (more details), 2.84 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: wwp1, ubv p2.3 and ubch7
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 L3

SCOPe Domain Sequences for d5hptc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hptc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aasrrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaey
pfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehpl
radlaeeyskdrkkfcknaeeftkkygekrp

SCOPe Domain Coordinates for d5hptc_:

Click to download the PDB-style file with coordinates for d5hptc_.
(The format of our PDB-style files is described here.)

Timeline for d5hptc_: