Lineage for d5hcua1 (5hcu A:1-540)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2150570Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2150837Protein automated matches [190065] (6 species)
    not a true protein
  7. 2150918Species Mouse (Mus musculus) [TaxId:10090] [187006] (55 PDB entries)
  8. 2151023Domain d5hcua1: 5hcu A:1-540 [314894]
    Other proteins in same PDB: d5hcua2
    automated match to d2whqa_

Details for d5hcua1

PDB Entry: 5hcu (more details), 2.42 Å

PDB Description: crystal structure of mouse acetylchoinesterase inhibited by dfp
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d5hcua1:

Sequence, based on SEQRES records: (download)

>d5hcua1 c.69.1.1 (A:1-540) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

Sequence, based on observed residues (ATOM records): (download)

>d5hcua1 c.69.1.1 (A:1-540) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgd
flsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrig
vpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvy
ayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfart
gdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

SCOPe Domain Coordinates for d5hcua1:

Click to download the PDB-style file with coordinates for d5hcua1.
(The format of our PDB-style files is described here.)

Timeline for d5hcua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hcua2
View in 3D
Domains from other chains:
(mouse over for more information)
d5hcub_