SCOPe 2.06: Domain d5hpla_: 5hpl A:

Lineage for d5hpla_ (5hpl A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
   consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation

4. Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families)
   automatically mapped to Pfam PF00632

5. Family d.148.1.0: automated matches [227207] (1 protein)
   not a true family

6. Protein automated matches [226939] (2 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:4932] [314772] (1 PDB entry)

8. Domain d5hpla_: 5hpl A: [314875]
   automated match to d2xbba_

Details for d5hpla_

PDB Entry: 5hpl, 2.31 Å

PDB Description: system-wide modulation of hect e3 ligases with selective ubiquitin variant probes: rsp5 and ubv r5.4

PDB Compounds: (A:) Rsp5

SCOPe Domain Sequences for d5hpla_:

Sequence; same for both SEQRES and ATOM records:

>d5hpla_ d.148.1.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
dfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfdgeeg
ldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfigrvvg
lgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldltfsa
dderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfnelipe
dlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneqrarl
lqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdydsmk
qkltlaveet

Timeline for d5hpla_:

• d5hpla_ is new in SCOPe 2.06-stable
  
• d5hpla_ appears in SCOPe 2.07
  
• d5hpla_ appears in the current release, SCOPe 2.08