Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.0: automated matches [227207] (1 protein) not a true family |
Protein automated matches [226939] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [314772] (1 PDB entry) |
Domain d5hpla_: 5hpl A: [314875] Other proteins in same PDB: d5hplc1, d5hplc2, d5hpld1, d5hpld2 automated match to d2xbba_ |
PDB Entry: 5hpl (more details), 2.31 Å
SCOPe Domain Sequences for d5hpla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hpla_ d.148.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfdgeeg ldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfigrvvg lgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldltfsa dderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfnelipe dlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneqrarl lqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdydsmk qkltlaveet
Timeline for d5hpla_: