Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Agrobacterium fabrum [TaxId:176299] [314806] (3 PDB entries) |
Domain d5hwnc1: 5hwn C:1-303 [314845] Other proteins in same PDB: d5hwnb2, d5hwnc2 automated match to d4ur7a_ complexed with fmt, gol, pyr |
PDB Entry: 5hwn (more details), 1.5 Å
SCOPe Domain Sequences for d5hwnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hwnc1 c.1.10.0 (C:1-303) automated matches {Agrobacterium fabrum [TaxId: 176299]} mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk rka
Timeline for d5hwnc1:
View in 3D Domains from other chains: (mouse over for more information) d5hwna_, d5hwnb1, d5hwnb2, d5hwnd_ |