Lineage for d5hwma1 (5hwm A:1-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2835991Species Agrobacterium fabrum [TaxId:176299] [314806] (3 PDB entries)
  8. 2836000Domain d5hwma1: 5hwm A:1-303 [314834]
    Other proteins in same PDB: d5hwma2
    automated match to d4ur7a_
    complexed with fmt, oog

Details for d5hwma1

PDB Entry: 5hwm (more details), 2.1 Å

PDB Description: crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid
PDB Compounds: (A:) Probable 5-dehydro-4-deoxyglucarate dehydratase

SCOPe Domain Sequences for d5hwma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwma1 c.1.10.0 (A:1-303) automated matches {Agrobacterium fabrum [TaxId: 176299]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
rka

SCOPe Domain Coordinates for d5hwma1:

Click to download the PDB-style file with coordinates for d5hwma1.
(The format of our PDB-style files is described here.)

Timeline for d5hwma1: